PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 59269
Common NameSELMODRAFT_59269
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family SRS
Protein Properties Length: 122aa    MW: 13484.1 Da    PI: 9.4116
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
59269genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF70285.99.4e-271551266
  DUF702 12 GnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaas 66
            GnqakkdC+++RCRtCCksr+fdC+thvkstWvpaa+rr+r ++++a       s
   59269  1 GNQAKKDCQFQRCRTCCKSRSFDCQTHVKSTWVPAAHRRNRGAAAHAGGDAMIDS 55
            9****************************************77766654444333 PP

2DUF70282.79.3e-266312193151
  DUF702  93 saeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqG 151
             s+ ++++   + +P+ev+++avfrcv+++sv+dge+e+aYqt+v igGh+fkG+L+d+G
   59269  63 SGLPRSKRARAAFPAEVRAQAVFRCVKLTSVEDGEDEYAYQTTVRIGGHIFKGVLHDRG 121
             445555666677*********************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051424.1E-461121IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016235.4E-24138IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.9E-2874122IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
GNQAKKDCQF QRCRTCCKSR SFDCQTHVKS TWVPAAHRRN RGAAAHAGGD AMIDSSSYDH  60
ESSGLPRSKR ARAAFPAEVR AQAVFRCVKL TSVEDGEDEY AYQTTVRIGG HIFKGVLHDR  120
GI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002978643.14e-87hypothetical protein SELMODRAFT_59269, partial
SwissprotQ9SD402e-38SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
SwissprotQ9SJT82e-40SRS3_ARATH; Protein SHI RELATED SEQUENCE 3
TrEMBLD8S5N94e-87D8S5N9_SELML; Putative uncharacterized protein (Fragment)
STRINGEFJ200901e-86(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13131549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21400.11e-39SHI-related sequence3
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]